PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.XK813
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 315aa    MW: 35847.7 Da    PI: 8.7872
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.XK813genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.13.5e-32194248155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  k+r+rWt++LHe+Fve+v++LGG++kAtPk++l++m+ +gLt+ hvkSHLQkYR+
  Araip.XK813 194 KTRIRWTQDLHEKFVECVNRLGGADKATPKAVLKMMDSDGLTIFHVKSHLQKYRI 248
                  68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.213191251IPR017930Myb domain
SuperFamilySSF466895.55E-17192248IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-28192249IPR009057Homeodomain-like
TIGRFAMsTIGR015575.7E-23194249IPR006447Myb domain, plants
PfamPF002499.2E-9198247IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MNENKIDYCR GMIQQSQGGL FDTIQCWNMV GGGSRPPLPP QIGPAATIMS RFESPASAFY  60
AAELCMGFAE YEHSQAQFSK MNNNNNNNDL EFPLYQRDKF DLSNTLQAMV NSQFNTKNQC  120
FRSSNKIPCD NFPARKFHHQ QKFFTDAMTS PFPNKGNQDN IVSFDSYQDR SPTPSSGGSV  180
SANSASNGVT ISSKTRIRWT QDLHEKFVEC VNRLGGADKA TPKAVLKMMD SDGLTIFHVK  240
SHLQKYRIAK YMPDPIHNGI FIFLPLLIIV HFFLLCFWKS EKRIHIENLQ HQHLHLDMKR  300
IRESCSCESR NKVGS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016207443.10.0PREDICTED: uncharacterized protein LOC107647907
TrEMBLI1JNJ75e-90I1JNJ7_SOYBN; Uncharacterized protein
STRINGGLYMA03G29940.11e-89(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37403465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.22e-36G2-like family protein